PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_10668A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 286aa    MW: 30349 Da    PI: 5.0981
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_10668AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK66.93.2e-21227273248
                     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                                e++++l+d+s+yF+lp+++A+keLgvc+TvLK   R +GI+RWPhRk
  Oropetium_20150105_10668A 227 ENKLELHDISRYFHLPMAKACKELGVCATVLKGLRRTFGIERWPHRK 273
                                6899******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.163213285IPR003035RWP-RK domain
PfamPF020423.1E-18230274IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MAAHNGNDGS AAEGQWPYNP LLVLDGCDFD GVHAPGSGGL DFLGGLYFPP PMQNVTTDAY  60
GGNAFEWTEL PGNGAYSTTA NGSAPPTAAG TTIISAAASP TPPSAAQKGA LDCTAGCQIL  120
REIVHSNGLD ETTKLCPGLF YHATLEVSHA NNPEGLAPAP SFMGRDYAWV RNYLMNYAQE  180
RAAGGYTIVH DSISDFVSVL CTSMASAGID DQRHEVEAAP AEAEKGENKL ELHDISRYFH  240
LPMAKACKEL GVCATVLKGL RRTFGIERWP HRKAMITIKD NWTSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-10RWP-RK domain-containing protein